Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136957-20 20 µg $405 
LS-G136957-100 100 µg $598 
LS-G136957-1 1 mg $1,679 
ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
1 of 3
2 of 3
3 of 3

Human ARID1A / BAF250 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136957

Human ARID1A / BAF250 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136957

Description:
ARID1A / BAF250 Protein LS-G136957 is a Recombinant Human ARID1A / BAF250 produced in E. coli 1976-2231aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136957-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
ARID1A / BAF250 Protein LS-G136957 is a Recombinant Human ARID1A / BAF250 produced in E. coli 1976-2231aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
ARID1A / BAF250
Synonyms
ARID1A | BAF250 | BAF250a | BRG1-associated factor 250a | C1orf4 | BRG1-associated factor 250 | ELD | HOSA1 | Osa homolog 1 | OSA1 | OSA1 nuclear protein | SMARCF1 | MRD14 | p270 | B120 | BM029 | Brain protein 120 | C10rf4 | HELD | SWI-like protein | SWI/SNF complex protein p270
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1976-2231aa
Predicted Molecular Weight
33.4 kDa
AA Sequence
SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ARID1A / BAF250
O14497 NM_006015 NP_006006.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/24/2024