Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136577-20 20 µg $395 
LS-G136577-100 100 µg $570 
LS-G136577-1 1 mg $1,973 
CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
CD63 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
CD63 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Human CD63 Protein (Recombinant 6His, N-terminus) - LS-G136577

Human CD63 Protein (Recombinant 6His, N-terminus) - LS-G136577

Description:
CD63 Protein LS-G136577 is a Recombinant Human CD63 produced in Yeast 103-203aa with 6His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$395
LS-G136577-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CD63 Protein LS-G136577 is a Recombinant Human CD63 produced in Yeast 103-203aa with 6His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
CD63
Synonyms
CD63 | CD63 molecule | LAMP-3 | ME491 | Granulophysin | MLA1 | Tetraspanin-30 | Tspan-30 | CD63 antigen | OMA81H | TSPAN30
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
103-203aa
Predicted Molecular Weight
13.5 kDa
AA Sequence
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Expression System
Yeast
Source Species
Yeast
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CD63
P08962 NM_001780 NP_001771.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD63 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD63 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD63 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Mass Cytometry

CD63 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD63 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/22/2024