Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G140977-50 50 µg (1 mg/ml) $531 
LS-G140977-100 100 µg $756 
LS-G140977-200 200 µg $1,103 
LS-G140977-0.5 0.5 mg $1,475 
LS-G140977-1 1 mg $1,868 
LS-G140977-5 5 mg $3,201 
LS-G140977-10 10 mg $4,268 
Protein

Human NALP3 / NLRP3 Protein (Recombinant 6His, N-terminus + 6His, C-terminus) (aa220-536) - LS-G140977

Human NALP3 / NLRP3 Protein (Recombinant 6His, N-terminus + 6His, C-terminus) (aa220-536) - LS-G140977

Description:
NALP3 / NLRP3 Protein LS-G140977 is a Recombinant Human NALP3 / NLRP3 produced in E. coli AA 220-536 with 6His, N-terminus + 6His, C-terminus tag(s). It is low in endotoxin; Less than 0.1 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$531
LS-G140977-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
NALP3 / NLRP3 Protein LS-G140977 is a Recombinant Human NALP3 / NLRP3 produced in E. coli AA 220-536 with 6His, N-terminus + 6His, C-terminus tag(s). It is low in endotoxin; Less than 0.1 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
NALP3 / NLRP3
Synonyms
NLRP3 | AGTAVPRL | AII | C1orf7 | Caterpiller protein 1.1 | Cryopyrin | FCAS | FCU | PYPAF1 | NALP3 | CIAS1 | CLR1.1 | MWS
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus + 6His, C-terminus
Region
AA 220-536
Predicted Molecular Weight
34.87 kDa
AA Sequence
HTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCTGLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 0.1 EU/µg protein (determined by LAL method).
Presentation
50 mM NaH2PO4, pH 8.0, 500 mM NaCl, 500mM Imidazole, 10% glycerol
Storage
Aliquot and store at -20°C for 6 months. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NALP3 / NLRP3
Q96P20 NM_004895 NP_004886.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/25/2024