Target
RBP4
Synonyms
RBP4 | PRBP | Plasma retinol-binding protein | RBP | Retinol-binding protein 4
Conjugations
Unconjugated
Predicted Molecular Weight
22 kDa
AA Sequence
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLHHHHHH
Expression System
HEK 293 Cells
Purification
Greater than 97% by SDS-PAGE and RP-HPLC
Bio-Activity
Measured by its ability to bind all-trans retinoic acid. The binding of retinoic acid results in the quenching of Trp fluorescence in RBP4. >1.0 µM all-trans retinoic acid is bound under the described conditions. Assay Protocol: 1. Dilute rhRBP4 to 49 µg/mL in Assay Buffer. 2. Make serial dilutions of retinoic acid in 95% ethanol at 100, 30, 10, 3 and 1 µM. 3. The formation of Protein/Retinol binding in microtubes: 3.1. Mix 112.5 µL of 49 µg/mL rhRBP4 and 12.5 µL of retinoic acid serial dilutions in microtubes. 3.2. For a blank, mix 112.5 µL of 49 µg/mL rhRBP4 and 12.5 µL of 95% ethanol in a microtube. 4. Incubate reaction tubes at room temperature for 30 minutes. 5. In a plate load 100 µL of the reaction mixtures and blank. 6. Read at excitation and emission wavelengths of 280 nm and 340 nm (top read), respectively, in endpoint mode. 7. Calculate concentration at which 50% quenching of rhRBP4 is achieved by plotting raw RFUs vs. concentration of retinoic acid with 4-PL fitting. Use th
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a 0.2 um filtered solution in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl
Reconstitution
Reconstitute in ddH2O or PBS at 100 ug/ml.
Storage
Store lyophilized at -70°C or below for up to 6 months. Store reconstituted at 4°C for up to 1 week or at -20°C for up to 3 months. Add a carrier protein (0.1% BSA) for long term storage. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee