Fusion Protein

TIGIT

Human

Unmodified

40 kDa

CHO Cells

Hamster-Chinese

A soluble molecule consisting of the extracellular domain of mature human TIGIT fused to murine IgG2a Fc. Residual signal peptidce amino acids (7aa): kpqapel, Mature TIGIT(EC) (118aa): (22)mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgarfq(139), Linking amino acids (2aa): fq, Murine IgG2aFc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk. Predicted nonglycosylated monomeric weight: 40 kd. TIGIT-muIg runs as a dimer in SDS-PAGE with a molecular weight of approximately 100 kD. Five x 10^5 cultured U-937 human tumor cells were washed and pre incubated 10 minutes with 20ul of 300ug/ml human IgG (to reduce non specific binding), after which they were incubated 45 minutes on ice with 80 µl of TIGIT-muIg/Biotin at a concentration of 5 µg/ml. Cells were washed twice and incubated with secondary reagent Streptavidin/R-Phycoerythrin, after which they were washed twice, fixed and analyzed by FACS. Cells stained positive with a mean shift of 0.46 log10 fluorescent units when compared to Recombinant muIgFc/Biotin negative control. Binding was blocked when reagent was pre incubated with a >10 fold excess of recombinant CD155-muIg.

Not Tested

Not Tested

50 mM Sodium Phosphate, pH 7.5, 150 mM NaCl, 100 mM KCl, 0.04% Sodium Azide, 5% Glycerol, 0.2% BSA

Store at 2°C to 5°C for up to 1 year. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This protein carries the LSBio 100% Guarantee.

Uniprot: Q495A1 NCBI: Q495A1