Fusion Protein

TIGIT

Human

Preservative Free. Also available Unmodified.

40 kDa

CHO Cells

Hamster-Chinese

A soluble molecule consisting of the extracellular domain of mature human TIGIT fused to murine IgG2a Fc. Residual signal peptidce amino acids (7aa): kpqapel, Mature TIGIT(EC) (118aa): (22)mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgarfq(139), Linking amino acids (2aa): fq, Murine IgG2aFc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk. Predicted nonglycosylated monomeric weight: 40 kd.TIGIT-muIg runs as a dimer in SDS-PAGE with a molecular weight of approximately 100 kD. Human TIGIT-muIg is reactive in EIA utilizing GAM capture and detection with recombinant CD155-muIg/Biotin and SA/HRP. TIGIT-muIg was tested for FACS binding to human U-937cells. Five x 10^5 cells per tube were washed and pre incubated 10 minutes with 300ug/ml human Ig (to reduce nonspecific binding) after which they were incubated 45 minutes on ice with 80 ul of TIGIT-muIg at 10 µg/ml. Cells were then washed twice and incubated with 2o detector Goat anti-Mouse/FITC, after which they were washed three times, fixed and analyzed by FACS using a lymphoid gate. Cells stained positive with a mean shift of 0.57 log10 fluorescent units when compared to background.

Not Tested

Not Tested

50 mM Sodium Phosphate, pH 7.5, 150 mM NaCl, 100 mM KCl

Store at 2°C to 5°C for up to 6 months. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This protein carries the LSBio 100% Guarantee.

Uniprot: Q495A1 NCBI: Q495A1