Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G26053-10 10 µg $281 
LS-G26053-50 50 µg $442 
LS-G26053-200 200 µg $882 
LS-G26053-1 1 mg $1,989 
LS-G26053-2 2 mg $2,176 
LS-G26053-5 5 mg $3,081 
NALP3 / NLRP3 Protein - Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE

Mouse NALP3 / NLRP3 Protein (Recombinant His, N-Terminal) (aa671-1033) - LS-G26053

Mouse NALP3 / NLRP3 Protein (Recombinant His, N-Terminal) (aa671-1033) - LS-G26053

Description:
NALP3 / NLRP3 Protein LS-G26053 is a Recombinant Mouse NALP3 / NLRP3 produced in E. coli aa 671-1033 with His, N-Terminal tag(s). For Research Use Only
Price
Catalog Number
$281
LS-G26053-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
NALP3 / NLRP3 Protein LS-G26053 is a Recombinant Mouse NALP3 / NLRP3 produced in E. coli aa 671-1033 with His, N-Terminal tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
NALP3 / NLRP3
Synonyms
NLRP3 | AGTAVPRL | AII | C1orf7 | Caterpiller protein 1.1 | Cryopyrin | FCAS | FCU | PYPAF1 | NALP3 | CIAS1 | CLR1.1 | MWS
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His, N-Terminal
Region
aa 671-1033
Predicted Molecular Weight
43.9 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASMTGGQOMGRGSCHRVKTLSLGFFHNSPKEEEEERRGGRPLDQVQCVFPDTHVACSSRLVNCCLTSSFCRGLFSSLSTNRSLTELDLSDNTLGDPGMRVLCEALQHPGCNIQRLWLGRCGLSHQCCFDISSV LSSSQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLQKLWLVSCCLTSACCQDLALVLSS NHSLTRLYIGENALGDSGVQVLCEKMKDPQCNLQKLGLVNSGLTSICCSALTSVLKTNQNFTHLYLRSNALGDTGLRLLCEGLLHPDCKLQMLELDNCSLTSHSCWNLSTILTHNHSLRKLNLGNNDLGDLCVVTLCEVLKQQGCLLQSLQLGEMYLNRETKRALEALQEEKPELTIVFEISW
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 20mM Tris, 500mM NaCl, pH 8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose and ProClin300.
Reconstitution
Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/ml. Do not vortex.
Storage
Store at 4°C for up to 1 month, or aliquot and store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NALP3 / NLRP3
Q96P20 NM_004895 NP_004886.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NALP3 / NLRP3 Protein - Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE
Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NALP3 / NLRP3 Protein - Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE
Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NALP3 / NLRP3 Protein - Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE
Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NALP3 / NLRP3 Protein - Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE
Recombinant NLR Family, Pyrin Domain Containing Protein 3 By SDS-PAGE

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/25/2024