Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G3703-5 5 µg $282 
LS-G3703-20 20 µg $370 
Protein

Mouse TNF Alpha Protein (Recombinant) - LS-G3703

Mouse TNF Alpha Protein (Recombinant) - LS-G3703

Description:
TNF Alpha Protein LS-G3703 is a Recombinant Mouse TNF Alpha produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only
Price
Catalog Number
$282
LS-G3703-5
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TNF Alpha Protein LS-G3703 is a Recombinant Mouse TNF Alpha produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TNF Alpha
Synonyms
TNF | APC1 protein | Cachectin | DIF | TNF Alpha | Tumor necrosis factor-alpha | TNF-alpha | TNF-a | TNFA | Tumor necrosis factor | TNF, macrophage-derived | TNF, monocyte-derived | TNFSF2
Species
Mouse
Modifications
Animal-free. Also available Unmodified.
Conjugations
Unconjugated
AA Sequence
MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is <=0.1 ng/ml, corresponding to a specific activity of >=10^7 units/mg.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Presentation
Sterile filtered. Lyophilized from 10mM Sodium Phosphate pH 7.5.
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage it is recommended to further dilute in a buffer containing a carrier protein (example 5% Trehalose) and store in working aliquots at -20°C to -80°C.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNF Alpha
P01375 NM_000594 NP_000585.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/1/2024