Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G137343-20 20 µg $364 
LS-G137343-100 100 µg (1.36 mg/ml) $500 
LS-G137343-1 1 mg $1,679 
IL15RA Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
IL15RA Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
1 of 3
2 of 3
3 of 3

Human IL15RA Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G137343

Human IL15RA Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G137343

Description:
IL15RA Protein LS-G137343 is a Recombinant Human IL15RA produced in E. coli 31-205aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G137343-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
IL15RA Protein LS-G137343 is a Recombinant Human IL15RA produced in E. coli 31-205aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
IL15RA
Synonyms
IL15RA | CD215 antigen | IL-15RA | IL-15 receptor subunit alpha | IL-15R-alpha | Interleukin 15 receptor, alpha | CD215
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
31-205aa
Predicted Molecular Weight
23.4 kDa
AA Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL15RA
Q13261 NM_002189 NP_002180.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL15RA Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL15RA Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL15RA Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL15RA Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Mass Cytometry

IL15RA Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL15RA.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/27/2024