Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G20643-20 20 µg $405 
LS-G20643-50 50 µg (0.5 mg/ml) $422 
LS-G20643-100 100 µg $598 
LS-G20643-1 1 mg $1,679 
CTSD / Cathepsin D Protein

Hamster-Chinese CTSD / Cathepsin D Protein (Recombinant His-SUMO) (aa65-408) - LS-G20643

Hamster-Chinese CTSD / Cathepsin D Protein (Recombinant His-SUMO) (aa65-408) - LS-G20643

Description:
CTSD / Cathepsin D Protein LS-G20643 is a Recombinant Hamster-Chinese CTSD / Cathepsin D produced in E. coli aa 65-408 with His-SUMO tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G20643-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CTSD / Cathepsin D Protein LS-G20643 is a Recombinant Hamster-Chinese CTSD / Cathepsin D produced in E. coli aa 65-408 with His-SUMO tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
CTSD / Cathepsin D
Synonyms
CTSD | CPSD | CLN10 | Lysosomal aspartyl peptidase | Lysosomal aspartyl protease | ProCathepsin D | CatD | Cathepsin D
Species
Hamster-Chinese
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 65-408
Predicted Molecular Weight
53.28 kD
AA Sequence
GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CTSD / Cathepsin D
P07339 NM_001909 NP_001900.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CTSD / Cathepsin D Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CTSD / Cathepsin D Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CTSD / Cathepsin D Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CTSD / Cathepsin D Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024