Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G27234-5 5 µg $278 
LS-G27234-25 25 µg $364 
Protein

Human FGF7 / KGF Protein (Recombinant) - LS-G27234

Human FGF7 / KGF Protein (Recombinant) - LS-G27234

Description:
FGF7 / KGF Protein LS-G27234 is a Recombinant Human FGF7 / KGF produced in CHO Cells. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$278
LS-G27234-5
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
FGF7 / KGF Protein LS-G27234 is a Recombinant Human FGF7 / KGF produced in CHO Cells. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FGF7 / KGF
Synonyms
FGF7 | FGF-7 | Fibroblast growth factor- 7 | Keratinocyte growth factor | Fibroblast growth factor 7 | HBGF-7 | KGF
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
16-18 kDa (SDS-PAGE)
AA Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
ED50 < 1 ng /ml, measured in a proliferation assay using 4MBr5 cells.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Chromatographically purified murine lgG fraction in 50mM PBS, pH 7.4 with 0.1% NaN3.
Reconstitution
Reconstitute in ddH2O or PBS at 100 µg/ml.
Storage
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 1 week or at -20°c for up to 2 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGF7 / KGF
P21781 NM_002009 NP_002000.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024