Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5854-10 10 µg $388 
LS-G5854-100 100 µg $1,359 
LS-G5854-500 500 µg $2,723 
IL1A / IL-1 Alpha Protein

Rhesus monkey IL1A / IL-1 Alpha Protein (Recombinant) (aa113-271) - LS-G5854

Rhesus monkey IL1A / IL-1 Alpha Protein (Recombinant) (aa113-271) - LS-G5854

Description:
IL1A / IL-1 Alpha Protein LS-G5854 is a Recombinant Rhesus monkey IL1A / IL-1 Alpha produced in E. coli aa 113-271. It is biologically active. For Research Use Only
Price
Catalog Number
$388
LS-G5854-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
IL1A / IL-1 Alpha Protein LS-G5854 is a Recombinant Rhesus monkey IL1A / IL-1 Alpha produced in E. coli aa 113-271. It is biologically active. For Research Use Only

Specifications

Type
Recombinant Protein
Target
IL1A / IL-1 Alpha
Synonyms
IL1A | Hematopoietin-1 | IL-1 alpha | IL1 | IL1-ALPHA | IL1 Alpha | Interleukin-1 alpha | IL-1A | IL1F1 | Pro-interleukin-1-alpha | Preinterleukin 1 alpha | Interleukin 1, alpha
Species
Rhesus monkey
Modifications
Unmodified
Conjugations
Unconjugated
Region
aa 113-271
Predicted Molecular Weight
18.1 kDa
AA Sequence
SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 97% by SDS-PAGE and HPLC
Bio-Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 x 108 IU/mg.
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Reconstitution
Reconstitute in sterile distilled water to 0.1-1 mg/ml.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL1A / IL-1 Alpha
P01583 NM_000575 NP_000566.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024