Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G137108-20 | 20 µg | $405 |
| LS-G137108-100 | 100 µg | $598 |
| LS-G137108-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Rat S100A4 / FSP1 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G137108
Rat S100A4 / FSP1 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G137108
Description:
S100A4 / FSP1 Protein LS-G137108 is a Recombinant Rat S100A4 / FSP1 produced in E. coli 2-101aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
S100A4 / FSP1 Protein LS-G137108 is a Recombinant Rat S100A4 / FSP1 produced in E. coli 2-101aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
S100A4 / FSP1
Synonyms
S100A4 | 42A | 18A2 | Fibroblast-specific protein-1 | FSP1 | MTS1 | PEL98 | Protein Mts1 | Calvasculin | CAPL | Metastasin | p9KA | Protein S100-A4
Species
Rat
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
2-101aa
Predicted Molecular Weight
18.6 kDa
AA Sequence
ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About S100A4 / FSP1
Publications (0)
Customer Reviews (0)
Images
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Protein S100-A4(S100a4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Popular S100A4 / FSP1 Proteins
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/22/2024
Date Requested: 11/22/2024
