LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (800) 227-6666


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > ADRBK1 / GRK2 > LS-C662968
 
Print Page  
Catalog Number Size Price
LS-C662968-10 10 µg $318 
LS-C662968-100 100 µg $470 
ADRBK1 / GRK2 Antibody - Western blot analysis of GRK2 using anti-GRK2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates,Lane 2: rat stomach tissue lysates,Lane 3: mouse lung tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: mouse pancreas tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK2 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GRK2 at approximately 79KD. The expected band size for GRK2 is at 79KD.
ADRBK1 / GRK2 Antibody - Western blot analysis of GRK2 using anti-GRK2 antibody
ADRBK1 / GRK2 Antibody - Western blot analysis of GRK2 using anti-GRK2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates,Lane 2: rat stomach tissue lysates,Lane 3: mouse lung tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: mouse pancreas tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK2 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GRK2 at approximately 79KD. The expected band size for GRK2 is at 79KD.
ADRBK1 / GRK2 Antibody - Western blot analysis of GRK2 using anti-GRK2 antibody
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human ADRBK1 / GRK2 Antibody (WB) LS‑C662968

Polyclonal Rabbit anti‑Human ADRBK1 / GRK2 Antibody (WB) LS‑C662968

Submit Review LSBio Guarantee
Antibody:
ADRBK1 / GRK2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662968-10
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
ADRBK1 / GRK2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
GRK2 antibody LS-C662968 is an unconjugated rabbit polyclonal antibody to human GRK2 (ADRBK1). Validated for WB.
Target
Human ADRBK1 / GRK2
Synonyms
ADRBK1 | BARK1 | Beta-ARK-1 | BETA-ARK1 | BARK | Betaark1 | GRK2
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
Specificity
Expressed in peripheral blood leukocytes.
Applications
  • Western blot
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ADRBK1 / GRK2
P25098 NM_001619 NP_001610.2

Publications (0)

Submit a Publication for LS-C662968

Customer Reviews (0)

Submit a review for LS-C662968

Featured Products

ADRBK1 / GRK2 Antibody - Formalin-fixed and paraffin-embedded human lung carcinoma tissue reacted with GRK2 Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
ADRBK1 / GRK2 Antibody (aa633‑660) LS‑C98902
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
ADRBK1 / GRK2 Antibody - Immunohistochemical analysis of GRK2 (pS29) staining in human brain formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
ADRBK1 / GRK2 Antibody (phospho‑Ser29) LS‑C351799
Species: Human, Mouse, Rat, Bovine
Applications: IHC, IHC - Paraffin, Western blot
ADRBK1 / GRK2 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE). This image was taken for the unconjugated form of this product. Other forms have not been tested.
IHC‑plus™ ADRBK1 / GRK2 Antibody LS‑B12295
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
ADRBK1 / GRK2 Antibody - Western blot analysis of lysates from HT29 cells treated with insulin 0.01U/ml 15', using GRK2 (Phospho-Ser685) Antibody. The lane on the right is blocked with the phospho peptide.
ADRBK1 / GRK2 Antibody (phospho‑Ser685) LS‑C199027
Species: Human, Mouse, Rat
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
ADRBK1 / GRK2 Antibody - Immunohistochemical analysis of GRK2 staining in human prostate cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
ADRBK1 / GRK2 Antibody (N‑Terminus) LS‑C358899
Species: Human, Mouse, Rat, Bovine
Applications: IHC, IHC - Paraffin, Western blot
ADRBK1 / GRK2 Antibody - Western Blot; Sample: Recombinant ADRbK1, Human.
ADRBK1 / GRK2 Antibody (aa398‑640, Biotin) LS‑C686843
Species: Human
Applications: Western blot
See all ADRBK1 / GRK2 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/3/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (800) 227-6666

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com