Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G271-2 2 µg $268 
LS-G271-10 10 µg $349 
Protein

Human THPO / TPO / Thrombopoietin Protein (Recombinant) - LS-G271

Human THPO / TPO / Thrombopoietin Protein (Recombinant) - LS-G271

Description:
THPO / TPO / Thrombopoietin Protein LS-G271 is a Recombinant Human THPO / TPO / Thrombopoietin produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only
Price
Catalog Number
$268
LS-G271-2
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
THPO / TPO / Thrombopoietin Protein LS-G271 is a Recombinant Human THPO / TPO / Thrombopoietin produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
THPO / TPO / Thrombopoietin
Synonyms
THPO | C-mpl ligand | MGDF | MPL ligand | THCYT1 | Thrombopoietin nirs variant 1 | MKCSF | MPLLG | Thrombopoietin
Species
Human
Modifications
Unmodified. Also available Animal-free.
Conjugations
Unconjugated
Predicted Molecular Weight
18.6 kDa
AA Sequence
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be <=1.0 ng/ml, corresponding to a specific activity of >=10^6 units/mg.
Endotoxin
Less than 0.1 ng/µg of protein (less than 1EU/µg).
Presentation
Sterile filtered, lyophilized from 10 mM sodium citrate, pH 3.0
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About THPO / TPO / Thrombopoietin
P40225 NM_000460 NP_000451.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024