Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G137026-20 | 20 µg | $364 |
| LS-G137026-100 | 100 µg | $500 |
| LS-G137026-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Pig GH / Growth Hormone Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G137026
Pig GH / Growth Hormone Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G137026
Description:
GH / Growth Hormone Protein LS-G137026 is a Recombinant Pig GH / Growth Hormone produced in E. coli 1-216aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
GH / Growth Hormone Protein LS-G137026 is a Recombinant Pig GH / Growth Hormone produced in E. coli 1-216aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
GH / Growth Hormone
Synonyms
GH1 | Growth hormone | GH | GHN | IGHD1B | GH-N | Pituitary growth hormone | Growth hormone 1 | Somatotropin
Species
Pig
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-216aa
Predicted Molecular Weight
29.4 kDa
AA Sequence
MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About GH / Growth Hormone
Publications (0)
Customer Reviews (0)
Images
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Popular GH / Growth Hormone Proteins
Source:
E. coli
Tag:
His-T7
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/22/2024
Date Requested: 11/22/2024
