Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136835-10 10 µg $294 
LS-G136835-50 50 µg $391 
LS-G136835-500 500 µg $1,540 
LS-G136835-1 1 mg $2,269 
KITLG / SCF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Human KITLG / SCF Protein (Recombinant) - LS-G136835

Human KITLG / SCF Protein (Recombinant) - LS-G136835

Description:
KITLG / SCF Protein LS-G136835 is a Recombinant Human KITLG / SCF produced in E. coli 26-189aa. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$294
LS-G136835-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
KITLG / SCF Protein LS-G136835 is a Recombinant Human KITLG / SCF produced in E. coli 26-189aa. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
KITLG / SCF
Synonyms
KITLG | C-Kit ligand | KIT ligand | Kitl | KL-1 | SHEP7 | SF | Steel factor | Stem cell factor | SCF | FPH2 | Mast cell growth factor | MGF
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Region
26-189aa
Predicted Molecular Weight
18.4 kDa
AA Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Usage Summary
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Bio-Activity
The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 20 ng/ml.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from 0.2 µm filtered 20 mM PB, pH 7.0, 150 mM NaCl.
Reconstitution
Briefly centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml.
Storage
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About KITLG / SCF
P21583 NM_000899 NP_000890.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

KITLG / SCF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

KITLG / SCF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

KITLG / SCF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

KITLG / SCF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024