Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G137884-10 10 µg $321 
LS-G137884-50 50 µg $534 
LS-G137884-500 500 µg $1,680 
LS-G137884-1 1 mg $2,353 
Protein

Human IL22 Protein (Recombinant 6His, C-terminus) - LS-G137884

Human IL22 Protein (Recombinant 6His, C-terminus) - LS-G137884

Description:
IL22 Protein LS-G137884 is a Recombinant Human IL22 produced in Mammalian Cells with 6His, C-terminus tag(s). It is low in endotoxin; Less than 0.1 ng/mL (Less than 1 EU/µg) (determined by LAL method). For Research Use Only
Price
Catalog Number
$321
LS-G137884-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
IL22 Protein LS-G137884 is a Recombinant Human IL22 produced in Mammalian Cells with 6His, C-terminus tag(s). It is low in endotoxin; Less than 0.1 ng/mL (Less than 1 EU/µg) (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
IL22
Synonyms
IL22 | Cytokine Zcyto18 | ILTIF | Interleukin 22 | IL-22 | IL-D110 | TIFIL-23 | Zcyto18 | IL-TIF | Interleukin-22
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, C-terminus
AA Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIGSHHHHHH
Expression System
Mammalian Cells
Source Species
Human
Purification
Greater than 95% as determined by reducing SDS-PAGE.
Bio-Activity
Not Tested
Endotoxin
Less than 0.1 ng/mL (Less than 1 EU/µg) (determined by LAL method).
Presentation
Lyophilized from a sterile solution in PBS, pH 7.4.
Reconstitution
Reconstitute with ddH2O. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Minimum recommended concentration for storage is 100 µg/ml. Minimize freeze-thaw cycles.
Storage
Before reconstitution: short term; store at room temperature for up to 3 weeks, long term; store at -20°C. After Reconstitution: short term; store at 4°C to 7°C for up to 7 days, long term; Aliquot and store at -20°C for up to 3 months. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL22
Q9GZX6 NM_020525 NP_065386.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024