Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G27201-10 10 µg $273 
LS-G27201-50 50 µg $364 
LS-G27201-1 1 mg $1,513 
Protein

Human TNFSF12 / TWEAK Protein (Recombinant) - LS-G27201

Human TNFSF12 / TWEAK Protein (Recombinant) - LS-G27201

Description:
TNFSF12 / TWEAK Protein LS-G27201 is a Recombinant Human TNFSF12 / TWEAK produced in CHO Cells. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$273
LS-G27201-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TNFSF12 / TWEAK Protein LS-G27201 is a Recombinant Human TNFSF12 / TWEAK produced in CHO Cells. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TNFSF12 / TWEAK
Synonyms
TNFSF12 | APO3/DR3 ligand | APO3L | DR3LG | APO3 ligand | TWEAK
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
20-22 kDa (SDS-PAGE)
AA Sequence
RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
ED50 < 1 ng/ml, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Reconstitution
Reconstitute in ddH2O or PBS at 100 µg/ml.
Storage
Stable at -70°c for up to 6 months. Upon reconstitution, store at 4°c for up to 1 week or at -20°c for up to 2 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNFSF12 / TWEAK
O43508 NM_003809 NP_003800.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024