Research Areas
Quick Order
Cart Cart lightblue
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us


Orders Processing,
Shipping & Receiving,

2 Shaker Rd Suites
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us

Additional Contact Details

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C335279-20 20 µl $275 
LS-C335279-100 100 µl $389 
EDNRB / Endothelin B Receptor Antibody - Western blot analysis of extracts of various cells.

Polyclonal Rabbit anti‑Human EDNRB / Endothelin B Receptor Antibody (WB) LS‑C335279

Polyclonal Rabbit anti‑Human EDNRB / Endothelin B Receptor Antibody (WB) LS‑C335279

EDNRB / Endothelin B Receptor Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


EDNRB / Endothelin B Receptor Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


Endothelin B Receptor antibody LS-C335279 is an unconjugated rabbit polyclonal antibody to Endothelin B Receptor (EDNRB) from human. It is reactive with human and mouse. Validated for WB.
Human EDNRB / Endothelin B Receptor
EDNRB | ABCDS | Endothelin B receptor | Etb receptor | ET-B | Et-b receptor | Et-b-r | ET-RB | ETBR | ETRB | Etb-svr | WS4A | Endothelin receptor type B | ET-BR | ETB | HSCR | HSCR2
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EDNRB (NP_001116131.1). MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF
Human EDNRB / Endothelin B Receptor
  • Western blot (1:500 - 1:2000)
The predicted MW is 48kDa/49kDa/59kDa, while the observed MW by Western blot was 50kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About EDNRB / Endothelin B Receptor
P24530 NM_000115 NP_000106.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 7/22/2024