Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B14351-50 50 µl (0.58 mg/ml) $460 
IL7 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
IL7 Antibody - Immunofluorescence analysis of MCF-7 cells using IL7 antibody. Blue: DAPI for nuclear staining.
IL7 Antibody - Western blot analysis of extracts of various cell lines, using IL7 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
IL7 Antibody - Western blot analysis of extracts of various cell lines, using IL7 antibody.
IL7 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
IL7 Antibody - Immunofluorescence analysis of MCF-7 cells using IL7 antibody. Blue: DAPI for nuclear staining.
IL7 Antibody - Western blot analysis of extracts of various cell lines, using IL7 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
IL7 Antibody - Western blot analysis of extracts of various cell lines, using IL7 antibody.
1 of 4
2 of 4
3 of 4
4 of 4

IHC‑plus™ Polyclonal Rabbit anti‑Human IL7 Antibody (IHC, IF, WB) LS‑B14351

IHC‑plus™ Polyclonal Rabbit anti‑Human IL7 Antibody (IHC, IF, WB) LS‑B14351

Note: This antibody replaces LS-C335170
Antibody:
IL7 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B14351-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
IL7 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
IL7 antibody LS-B14351 is an unconjugated rabbit polyclonal antibody to IL7 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues. Cited in 1 publication.
Target
Human IL7
Synonyms
IL7 | IL-7 | Interleukin-7 | Interleukin 7
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 26-177 of human IL7 (NP_000871.1). DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Specificity
Human IL7
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 7kDa/15kDa/20kDa, while the observed MW by Western blot was 33kDa.
Presentation
PBS with 0.05% proclin300, 50% glycerol, pH7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL7
P13232 NM_000880 NP_000871.1

Validation

IL7 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ IL7 Antibody for IHC, IF/Immunofluorescence, WB/Western LS-B14351 has an LSBio Rating of
Publications (4)
Laboratory Validation Score (4)

Publications (1)

Stress-Induced Changes in Bone Marrow Stromal Cell Populations Revealed through Single-Cell Protein Expression Mapping. Nicolas Severe, Nezihi Murat Karabacak, Karin Gustafsson, Ninib Baryawno, Gabriel Courties, Youmna Kfoury, Konstantinos D Kokkaliaris, Catherine Rhee, Dongjun Lee, Elizabeth W Scadden, Juan Esteban Garcia-Robledo, Thomas Brouse, Matthias Nahrendorf, Mehmet Toner, David T Scadden. Cell stem cell. 2019 October;25:570-583.e7.

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024