Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G330-5 5 µg $268 
LS-G330-25 25 µg $349 
Protein

Human TNFSF12 / TWEAK Protein (Recombinant) - LS-G330

Human TNFSF12 / TWEAK Protein (Recombinant) - LS-G330

Description:
TNFSF12 / TWEAK Protein LS-G330 is a Recombinant Human TNFSF12 / TWEAK produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only
Price
Catalog Number
$268
LS-G330-5
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TNFSF12 / TWEAK Protein LS-G330 is a Recombinant Human TNFSF12 / TWEAK produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TNFSF12 / TWEAK
Synonyms
TNFSF12 | APO3/DR3 ligand | APO3L | DR3LG | APO3 ligand | TWEAK
Species
Human
Modifications
Unmodified. Also available Animal-free.
Conjugations
Unconjugated
Predicted Molecular Weight
17.0 kDa
AA Sequence
MKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
Assay 1: The ED50 as determined by the dose-dependent stimulation of IL-8 production by Human PBMC is less than 10 ng/ml. Assay 2: TWEAK weakly induces the death of HT29 cells when cultured in the presence of IFN-gamma. The ED50 for this effect is between 30-45 ng/ml.
Endotoxin
Less than 0.1 ng/µg of protein (less than 1EU/µg).
Presentation
Sterile filtered, lyophilized from 10 mM sodium phosphate, pH 7.5, 0.1 M L-Arg
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in 10 mM Sodium Phosphate pH 7.5 to a concentration of 1.0 mg/ml. Do not vortex. For extended storage it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNFSF12 / TWEAK
O43508 NM_003809 NP_003800.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024