Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136945-10 10 µg $259 
LS-G136945-50 50 µg $342 
LS-G136945-500 500 µg $675 
LS-G136945-1 1 mg $834 
FGF2 / Basic FGF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Human FGF2 / Basic FGF Protein (Recombinant) (Full Length) - LS-G136945

Human FGF2 / Basic FGF Protein (Recombinant) (Full Length) - LS-G136945

Description:
FGF2 / Basic FGF Protein LS-G136945 is a Recombinant Human FGF2 / Basic FGF produced in E. coli 143-288aa. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$259
LS-G136945-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
FGF2 / Basic FGF Protein LS-G136945 is a Recombinant Human FGF2 / Basic FGF produced in E. coli 143-288aa. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FGF2 / Basic FGF
Synonyms
FGF2 | Basic fibroblast growth factor | FGFB | Fibroblast growth factor 2 | FGF-2 | Prostatropin | BFGF | HBGF-2
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Region
143-288aa
Predicted Molecular Weight
16.3 kDa
AA Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Usage Summary
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis
Bio-Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from 0.2 µm filtered PBS, pH 7.4
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGF2 / Basic FGF
P09038 NM_002006 NP_001997.5

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF2 / Basic FGF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF2 / Basic FGF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF2 / Basic FGF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF2 / Basic FGF Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024