Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G27265-10 10 µg $253 
LS-G27265-50 50 µg $296 
LS-G27265-1 1 mg $990 
Protein

Bovine FGF2 / Basic FGF Protein (Recombinant) - LS-G27265

Bovine FGF2 / Basic FGF Protein (Recombinant) - LS-G27265

Description:
FGF2 / Basic FGF Protein LS-G27265 is a Recombinant Bovine FGF2 / Basic FGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$253
LS-G27265-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
FGF2 / Basic FGF Protein LS-G27265 is a Recombinant Bovine FGF2 / Basic FGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FGF2 / Basic FGF
Synonyms
FGF2 | Basic fibroblast growth factor | FGFB | Fibroblast growth factor 2 | FGF-2 | Prostatropin | BFGF | HBGF-2
Species
Bovine
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
16.4 kDa (SDS-PAGE)
AA Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
ED50 < 1.0 ng/mL, as determined by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 1 x 10^6 units/mg.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Reconstitution
Reconstitute in ddH2O at 100 µg/ml
Storage
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 2 weeks or at -20°c for up to 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGF2 / Basic FGF
P09038 NM_002006 NP_001997.5

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/20/2024