Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G3628-10 10 µg $282 
LS-G3628-50 50 µg $369 
Protein

Human FGF2 / Basic FGF Protein (Recombinant) - LS-G3628

Human FGF2 / Basic FGF Protein (Recombinant) - LS-G3628

Description:
FGF2 / Basic FGF Protein LS-G3628 is a Recombinant Human FGF2 / Basic FGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only
Price
Catalog Number
$282
LS-G3628-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
FGF2 / Basic FGF Protein LS-G3628 is a Recombinant Human FGF2 / Basic FGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FGF2 / Basic FGF
Synonyms
FGF2 | Basic fibroblast growth factor | FGFB | Fibroblast growth factor 2 | FGF-2 | Prostatropin | BFGF | HBGF-2
Species
Human
Modifications
Animal-free. Also available Unmodified.
Conjugations
Unconjugated
AA Sequence
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
The ED50 as determined by a cell proliferation Assay using balb/c 3T3 cells is = 0.1 ng/ml, corresponding to a specific activity of = 1 x 10^7 units/mg.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Presentation
Sterile filtered through a 0.2-micron filter. Lyophilized from 10mM Sodium Phosphate, pH 7.4 + 112.5mM NaCl
Reconstitution
Centrifuge vial prior to opening. Do not vortex after reconstitution. Avoid repeated freeze-thaw cycles. Initially reconstitute in water to 0.1-1.0 mg/ml.
Storage
After reconstitution store at 2°C to 8°C for up to 1 week or for extended storage further dilute in a buffer containing a carrier protein or stabilizer (e.g. 5% Trehalose). Store working aliquots at -20°C to -80°C for a year.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGF2 / Basic FGF
P09038 NM_002006 NP_001997.5

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/1/2024